PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00408.1_g00016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 172aa    MW: 20024.2 Da    PI: 5.6613
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00408.1_g00016.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.81.5e-1580138563
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                              +++rr+++NRe+ArrsR RK+  ++eL   v  L  eN++L ++l++l++  +k+ +e+
  Rsa1.0_00408.1_g00016.1  80 RKQRRMISNRESARRSRMRKQRHLDELWSQVMWLRIENHQLLDKLNNLSESHEKVLQEN 138
                              689***************************************************99997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.4E-1476140IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.8E-1178133No hitNo description
PROSITE profilePS5021710.93278141IPR004827Basic-leucine zipper domain
PfamPF001706.5E-1480138IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.19E-1380130No hitNo description
CDDcd147025.82E-1981131No hitNo description
PROSITE patternPS0003608398IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MQPQPDVFSL QNYLNSSIPS AYPSHFQISS PFPINGQNPN SIYGFQSATN NPQSMSLSSN  60
NSTSDEADEQ QTDKNIINER KQRRMISNRE SARRSRMRKQ RHLDELWSQV MWLRIENHQL  120
LDKLNNLSES HEKVLQENAQ LKEETSELKQ VISDMQIQSP FSCFRDDIIP IE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19299RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00389DAPTransfer from AT3G30530Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0168781e-171AB016878.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MQP15.
GenBankCP0026861e-171CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013705375.11e-119PREDICTED: basic leucine zipper 43-like
SwissprotQ9FMC22e-67BZP43_ARATH; Basic leucine zipper 43
TrEMBLA0A078JMC71e-119A0A078JMC7_BRANA; BnaA06g39730D protein
STRINGBra025418.1-P1e-109(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31122667
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.14e-97basic leucine-zipper 42